PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA08g01890
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family TALE
Protein Properties Length: 572aa    MW: 64408.5 Da    PI: 6.7916
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA08g01890genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.93.9e-094905281854
                 HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 +F++  ++yp+ +e++ LA k gLt +qV++WF N R +
  CA08g01890 490 MFQNflHPYPKDAEKQLLAVKSGLTRSQVSNWFINARVR 528
                 5887779******************************88 PP

2BELL70.33.5e-23363430371
        BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeq 71 
                 ++ ++kk  L+ ll+ Vd++Y+q+ +++++vis+F+av++l++  +++++Alk+iS  +++L+++i++ 
  CA08g01890 363 MDSEAKKKNLVALLQVVDEQYNQCLDEIHMVISAFHAVTELDP-CIHARFALKTISSLYKNLRERISNY 430
                 67899**************************************.9*********************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.3E-16288429IPR006563POX domain
PfamPF075262.4E-25294428IPR006563POX domain
PROSITE profilePS5007111.224469532IPR001356Homeobox domain
SMARTSM003895.5E-7472536IPR001356Homeobox domain
CDDcd000862.05E-11472533No hitNo description
SuperFamilySSF466891.59E-15474541IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.5E-26475538IPR009057Homeodomain-like
PfamPF059204.1E-15489528IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009640Biological Processphotomorphogenesis
GO:0010073Biological Processmeristem maintenance
GO:0010227Biological Processfloral organ abscission
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010371Biological Processregulation of gibberellin biosynthetic process
GO:0090470Biological Processshoot organ boundary specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 572 aa     Download sequence    Send to blast
MTQPHTIIDE NYLHTAIVPI SFPDTVCLNN QKNIMYGQNH IMDGQEIPYP SMLQGEIINS  60
SQGCLNLPNF PRAVETEAIH NVLPAGRNRI KGSSFSTSYP ISNSYTEDQH MEGIPISAVS  120
LANLLAARNA VHENLENLAI VAPFSHPAEG QKIDGLDYPN VLNHSFGSYR NYEFDGVPEI  180
PGTVLGRAQS QPFQLTENVN SNTWFSSETA SLSSDSPSGS SRFSNELCLS LTTSQSAVVC  240
GPIIQDQCSD ISCSGVTNHA FPQRHFDSEL TSCNSRNLSL NFVSYKPVHL SQFLTGSRYL  300
RVMQEILSEI AQLSLQNHNL LGYRGMDCGA NTLSALSSDS ARGYAALHSD DLPDADHRFI  360
GQMDSEAKKK NLVALLQVVD EQYNQCLDEI HMVISAFHAV TELDPCIHAR FALKTISSLY  420
KNLRERISNY ILAMGEHFNK GGERGVEKSF ETSFIQKQWA LQQLKRKDHQ LWRPQRGLPE  480
RSVSVLRAWM FQNFLHPYPK DAEKQLLAVK SGLTRSQVSN WFINARVRLW KPMIEEMYAE  540
MNRRKIRTGN EDEANHRRNH RIIENHLFTM H*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-14478536563Homeobox protein Meis2
3k2a_B1e-14478536563Homeobox protein Meis2
4xrm_A1e-14478536563Homeobox protein Meis2
4xrm_B1e-14478536563Homeobox protein Meis2
4xrs_A7e-15478535158Homeobox protein Meis1
4xrs_B7e-15478535158Homeobox protein Meis1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754470.0HG975447.1 Solanum pennellii chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016537624.10.0PREDICTED: homeobox protein ATH1 isoform X1
SwissprotP487311e-101ATH1_ARATH; Homeobox protein ATH1
TrEMBLK4CLC20.0K4CLC2_SOLLC; Uncharacterized protein
STRINGSolyc08g065420.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA82612327
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.11e-102homeobox gene 1